Lineage for d1th7j_ (1th7 J:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312761Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1312762Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1312763Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1312764Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1312918Species Sulfolobus solfataricus [TaxId:2287] [141290] (1 PDB entry)
    Uniprot Q97ZQ0 1-76
    SnRNP-2
  8. 1312928Domain d1th7j_: 1th7 J: [119273]
    automated match to d1th7a1

Details for d1th7j_

PDB Entry: 1th7 (more details), 1.68 Å

PDB Description: Crystal Structure of an Archaeal Sm Protein from Sulfolobus solfataricus
PDB Compounds: (J:) Small nuclear riboprotein protein

SCOPe Domain Sequences for d1th7j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1th7j_ b.38.1.1 (J:) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]}
gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
klgtivirgdnvilispl

SCOPe Domain Coordinates for d1th7j_:

Click to download the PDB-style file with coordinates for d1th7j_.
(The format of our PDB-style files is described here.)

Timeline for d1th7j_: