SCOPe 2.05: Domain d1shzd2: 1shz D:46-75,D:201-371

Lineage for d1shzd2 (1shz D:46-75,D:201-371)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
   Uniprot P10824

8. Domain d1shzd2: 1shz D:46-75,D:201-371 [118967]
   Other proteins in same PDB: d1shza1, d1shzc_, d1shzd1, d1shzf_
   automatically matched to 1SHZ A:46-75,A:201-371
   complexed with alf, gdp, mg

Details for d1shzd2

PDB Entry: 1shz, 2.85 Å

PDB Description: crystal structure of the p115rhogef rgrgs domain in a complex with galpha(13):galpha(i1) chimera

PDB Compounds: (D:) Guanine Nucleotide-Binding Protein Galpha(13):Galpha(i1) Chimera

SCOPe Domain Sequences for d1shzd2:

Sequence; same for both SEQRES and ATOM records:

>d1shzd2 c.37.1.8 (D:46-75,D:201-371) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
arevkllllgagesgkstflkqmriihgqdXrptkgihethftfkdlhfkmfdvggqrse
rkkwfecfegvtaiifcvalsdydqvlmedrqtnrmhesmklfdsicnnkwftdtsiilf
lnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcat
dtknvqfvfdavtdviiknnlk

Timeline for d1shzd2:

• d1shzd2 first appeared in SCOP 1.73
  
• d1shzd2 appears in SCOPe 2.04
  
• d1shzd2 appears in SCOPe 2.06
  
• d1shzd2 appears in the current release, SCOPe 2.08