Lineage for d1sb2b1 (1sb2 B:2-128)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226631Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1226650Species Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId:8717] [143954] (1 PDB entry)
    Uniprot P81398 2-128
  8. 1226651Domain d1sb2b1: 1sb2 B:2-128 [118928]
    Other proteins in same PDB: d1sb2a1

Details for d1sb2b1

PDB Entry: 1sb2 (more details), 1.9 Å

PDB Description: High resolution Structure determination of rhodocetin
PDB Compounds: (B:) Rhodocetin beta subunit

SCOPe Domain Sequences for d1sb2b1:

Sequence, based on SEQRES records: (download)

>d1sb2b1 d.169.1.1 (B:2-128) Snake coagglutinin beta chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]}
frcpttwsasklycykpfkekktwieaerfcakqaenghlvsigsaaeadfldlvivvnf
dkqryrawtglternlkwtngasvsyenlyepyirkcfvvqpwegkskwykadceeknaf
lckfpkp

Sequence, based on observed residues (ATOM records): (download)

>d1sb2b1 d.169.1.1 (B:2-128) Snake coagglutinin beta chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]}
frcpttwsasklycykpfkekktwieaerfcakqaenghlvsigsaaeadfldlvivvnf
ryrawtglternlkwtngasvsyenlyepyirkcfvvqpwegkskwykadceeknaflck
fpkp

SCOPe Domain Coordinates for d1sb2b1:

Click to download the PDB-style file with coordinates for d1sb2b1.
(The format of our PDB-style files is described here.)

Timeline for d1sb2b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sb2a1