Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) |
Protein Lactate dehydrogenase [56339] (15 species) |
Species Mouse (Mus musculus) [TaxId:10090] [56341] (1 PDB entry) |
Domain d2ldxb2: 2ldx B:160-331 [118643] Other proteins in same PDB: d2ldxa1, d2ldxb1, d2ldxc1, d2ldxd1 duplicate of 2LDX 160-331 |
PDB Entry: 2ldx (more details), 2.96 Å
SCOPe Domain Sequences for d2ldxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ldxb2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} sgcnldsarfryligeklgvnptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigt dknkqhwknvhkqvveggyevldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgf hgikeevflsipcvlgesgitdfvkvnmtaeeegllkksadtlwnmqknlel
Timeline for d2ldxb2: