Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
Species Thermus aquaticus [TaxId:271] [51804] (2 PDB entries) |
Domain d1cera1: 1cer A:1-148,A:313-333 [118442] Other proteins in same PDB: d1cera2, d1cerb2, d1cerc2, d1cerd2, d1cero2, d1cerp2, d1cerq2, d1cerr2 duplicate of 1CER O:1-148,O:313-333 complexed with nad |
PDB Entry: 1cer (more details), 2.5 Å
SCOPe Domain Sequences for d1cera1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cera1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa kgeditivmgvnheaydpsrhhiisnasXnewgyanrvadlvelvlrkgv
Timeline for d1cera1: