Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries) |
Domain d1ausn2: 1aus N:20-147 [118412] Other proteins in same PDB: d1ausl1, d1ausm1, d1ausn1, d1auso1, d1auss_, d1aust_, d1ausu_, d1ausv_ duplicate of 1AUS L:20-147 complexed with fmt, mg |
PDB Entry: 1aus (more details), 2.2 Å
SCOPe Domain Sequences for d1ausn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ausn2 d.58.9.1 (N:20-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]} ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr ipvayvkt
Timeline for d1ausn2: