Lineage for d2benb_ (2ben B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770292Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1770317Protein Chitin-binding protein CBP21 [117045] (1 species)
    member of Pfam PF03067; elaborated fold with a large insertion between strands A and A'
  7. 1770318Species Serratia marcescens [TaxId:615] [117046] (3 PDB entries)
    Uniprot O83009 28-197
  8. 1770323Domain d2benb_: 2ben B: [116702]
    mutant

Details for d2benb_

PDB Entry: 2ben (more details), 1.8 Å

PDB Description: crystal structure of the serratia marcescens chitin-binding protein cbp21 y54a mutant.
PDB Compounds: (B:) cbp21

SCOPe Domain Sequences for d2benb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2benb_ b.1.18.2 (B:) Chitin-binding protein CBP21 {Serratia marcescens [TaxId: 615]}
hgyvespasrayqcklqlntqcgsvqaepqsveglkgfpqagpadghiasadkstffeld
qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk

SCOPe Domain Coordinates for d2benb_:

Click to download the PDB-style file with coordinates for d2benb_.
(The format of our PDB-style files is described here.)

Timeline for d2benb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bena_