Lineage for d1y6ja2 (1y6j A:149-317)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1225248Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1225249Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 1225250Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 1225257Protein Lactate dehydrogenase [56339] (15 species)
  7. 1225283Species Clostridium thermocellum [TaxId:1515] [118160] (1 PDB entry)
    Uniprot Q4CDK5
  8. 1225284Domain d1y6ja2: 1y6j A:149-317 [116508]
    Other proteins in same PDB: d1y6ja1
    Structural genomics target

Details for d1y6ja2

PDB Entry: 1y6j (more details), 3.01 Å

PDB Description: L-Lactate Dehydrogenase from Clostridium Thermocellum Cth-1135
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1y6ja2:

Sequence, based on SEQRES records: (download)

>d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]}
tvldsirfryllseklgvdvknvhgyiigehgdsqlplwscthiagknineyiddpkcnf
teedkkkiaedvktagatiiknkgatyygiavsintivetllknqntirtvgtvingmyg
iedvaislpsivnsegvqevlqfnltpeeeealrfsaeqvkkvlnevkn

Sequence, based on observed residues (ATOM records): (download)

>d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]}
tvldsirfryllseklgvdvknvhgyiigehgdsqlplwscthiagknineydkkkiaed
vktagatiiknkgatyygiavsintivetllknqntirtvgtvingmygiedvaislpsi
vnsegvqevlqfnltpeeeealrfsaeqvkkvlnevkn

SCOPe Domain Coordinates for d1y6ja2:

Click to download the PDB-style file with coordinates for d1y6ja2.
(The format of our PDB-style files is described here.)

Timeline for d1y6ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y6ja1