Lineage for d1xxig1 (1xxi G:243-368)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092611Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 1092612Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 1092613Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 1092631Protein gamma subunit [63578] (2 species)
  7. 1092632Species Escherichia coli [TaxId:562] [63579] (3 PDB entries)
    Uniprot P06710 5-368
  8. 1092645Domain d1xxig1: 1xxi G:243-368 [116195]
    Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib2, d1xxic2, d1xxid2, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig2, d1xxih2, d1xxii2, d1xxij1, d1xxij2
    protein/DNA complex; complexed with adp, po4, zn

Details for d1xxig1

PDB Entry: 1xxi (more details), 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex
PDB Compounds: (G:) DNA polymerase III subunit gamma

SCOPe Domain Sequences for d1xxig1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxig1 a.80.1.1 (G:243-368) gamma subunit {Escherichia coli [TaxId: 562]}
tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
mplpep

SCOPe Domain Coordinates for d1xxig1:

Click to download the PDB-style file with coordinates for d1xxig1.
(The format of our PDB-style files is described here.)

Timeline for d1xxig1: