![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class mu GST [81348] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries) Uniprot P09488 P28161 |
![]() | Domain d1xwkc1: 1xwk C:85-217 [116130] Other proteins in same PDB: d1xwka2, d1xwkb2, d1xwkc2 complexed with gdn |
PDB Entry: 1xwk (more details), 2.3 Å
SCOPe Domain Sequences for d1xwkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwkc1 a.45.1.1 (C:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp rpvfskmavwgnk
Timeline for d1xwkc1:
![]() Domains from other chains: (mouse over for more information) d1xwka1, d1xwka2, d1xwkb1, d1xwkb2 |