Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class mu GST [81359] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries) Uniprot P09488 ! Uniprot P28161 |
Domain d1xwkb2: 1xwk B:1-84 [116129] Other proteins in same PDB: d1xwka1, d1xwkb1, d1xwkc1 complexed with gdn |
PDB Entry: 1xwk (more details), 2.3 Å
SCOPe Domain Sequences for d1xwkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwkb2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgahkitqsnailcyiarkhn
Timeline for d1xwkb2:
View in 3D Domains from other chains: (mouse over for more information) d1xwka1, d1xwka2, d1xwkc1, d1xwkc2 |