Lineage for d1xw9c_ (1xw9 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2131618Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2131684Protein Thioredoxin [52835] (16 species)
  7. 2131790Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117589] (4 PDB entries)
    Uniprot Q9V429
  8. 2131802Domain d1xw9c_: 1xw9 C: [116114]

Details for d1xw9c_

PDB Entry: 1xw9 (more details), 2.3 Å

PDB Description: Drosophila thioredoxin, oxidized, P21
PDB Compounds: (C:) thioredoxin

SCOPe Domain Sequences for d1xw9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xw9c_ c.47.1.1 (C:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvyqvkdkadldgqltkasgklvvldffatwcgpckmispklvelstqfadnvvvlkvdv
decediameynissmptfvflkngvkveefaganakrledvikani

SCOPe Domain Coordinates for d1xw9c_:

Click to download the PDB-style file with coordinates for d1xw9c_.
(The format of our PDB-style files is described here.)

Timeline for d1xw9c_: