SCOP 1.75: Domain d1xuvc_: 1xuv C:

Lineage for d1xuvc_ (1xuv C:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (10 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (11 proteins)
   Pfam PF05146

6. Protein Hypothetical protein MM0500 [118095] (1 species)

7. Species Methanosarcina mazei [TaxId:2209] [118096] (1 PDB entry)
   Uniprot Q8PZJ2

8. Domain d1xuvc_: 1xuv C: [116071]
   Structural genomics target

Details for d1xuvc_

PDB Entry: 1xuv, 2.1 Å

PDB Description: x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10.

PDB Compounds: (C:) hypothetical protein MM0500

SCOP Domain Sequences for d1xuvc_:

Sequence; same for both SEQRES and ATOM records:

>d1xuvc_ d.129.3.5 (C:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]}
nptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttalkifepknggs
wqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarfealpgdrtkl
tshsvfqtiedrdgmlqsgmeegindsyerldellekmkkleh

Timeline for d1xuvc_:

• d1xuvc_ first appeared in SCOP 1.71
  
• d1xuvc_ appears in SCOP 1.73
  
• d1xuvc_ appears in SCOPe 2.01
  
• d1xuvc_ appears in the current release, SCOPe 2.08, called d1xuvc1