Lineage for d1xuvc_ (1xuv C:)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.129: TBP-like [55944] (9 superfamilies)
beta-alpha-beta(4)-alpha
Superfamily d.129.3: Bet v1-like [55961] (6 families) 
contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
Family d.129.3.5: Aha1 domain [111168] (4 proteins)
Pfam 05146
Protein Hypothetical protein MM0500 [118095] (1 species) Species Methanosarcina mazei [TaxId:2209] [118096] (1 PDB entry) 
Domain d1xuvc_: 1xuv C: [116071]
Structural genomics target
Details for d1xuvc_
PDB Entry: 1xuv (more details), 2.1 Å
PDB Description: x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10.
SCOP Domain Sequences for d1xuvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuvc_ d.129.3.5 (C:) Hypothetical protein MM0500 {Methanosarcina mazei}
nptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttalkifepknggs
wqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarfealpgdrtkl
tshsvfqtiedrdgmlqsgmeegindsyerldellekmkkleh
SCOP Domain Coordinates for d1xuvc_:
Click to download the PDB-style file with coordinates for d1xuvc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xuvc_:
- d1xuvc_ is new in SCOP 1.71
- d1xuvc_ appears in SCOP 1.73
- d1xuvc_ appears in the current release, SCOPe 2.08, called d1xuvc1
View in 3D
