Lineage for d1xuvc_ (1xuv C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733462Superfamily d.129.3: Bet v1-like [55961] (7 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 733590Family d.129.3.5: AHSA1 domain [111168] (7 proteins)
    Pfam PF05146
  6. 733613Protein Hypothetical protein MM0500 [118095] (1 species)
  7. 733614Species Methanosarcina mazei [TaxId:2209] [118096] (1 PDB entry)
  8. 733617Domain d1xuvc_: 1xuv C: [116071]
    Structural genomics target

Details for d1xuvc_

PDB Entry: 1xuv (more details), 2.1 Å

PDB Description: x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10.
PDB Compounds: (C:) hypothetical protein MM0500

SCOP Domain Sequences for d1xuvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuvc_ d.129.3.5 (C:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]}
nptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttalkifepknggs
wqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarfealpgdrtkl
tshsvfqtiedrdgmlqsgmeegindsyerldellekmkkleh

SCOP Domain Coordinates for d1xuvc_:

Click to download the PDB-style file with coordinates for d1xuvc_.
(The format of our PDB-style files is described here.)

Timeline for d1xuvc_: