Lineage for d1xsje4 (1xsj E:248-585)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 971484Family c.1.8.13: YicI catalytic domain-like [117372] (2 proteins)
  6. 971488Protein Putative glucosidase YicI, domain 2 [117373] (1 species)
  7. 971489Species Escherichia coli [TaxId:562] [117374] (5 PDB entries)
    Uniprot P31434
  8. 971500Domain d1xsje4: 1xsj E:248-585 [115970]
    Other proteins in same PDB: d1xsja1, d1xsja2, d1xsja3, d1xsjb1, d1xsjb2, d1xsjb3, d1xsjc1, d1xsjc2, d1xsjc3, d1xsjd1, d1xsjd2, d1xsjd3, d1xsje1, d1xsje2, d1xsje3, d1xsjf1, d1xsjf2, d1xsjf3
    complexed with trs

Details for d1xsje4

PDB Entry: 1xsj (more details), 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (E:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsje4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsje4 c.1.8.13 (E:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt

SCOPe Domain Coordinates for d1xsje4:

Click to download the PDB-style file with coordinates for d1xsje4.
(The format of our PDB-style files is described here.)

Timeline for d1xsje4: