SCOPe 2.02: Domain d1xsje1: 1xsj E:666-773

Lineage for d1xsje1 (1xsj E:666-773)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family)

5. Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)

6. Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)

7. Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
   Uniprot P31434

8. Domain d1xsje1: 1xsj E:666-773 [115967]
   Other proteins in same PDB: d1xsja2, d1xsja3, d1xsja4, d1xsjb2, d1xsjb3, d1xsjb4, d1xsjc2, d1xsjc3, d1xsjc4, d1xsjd2, d1xsjd3, d1xsjd4, d1xsje2, d1xsje3, d1xsje4, d1xsjf2, d1xsjf3, d1xsjf4
   complexed with trs

Details for d1xsje1

PDB Entry: 1xsj, 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase

PDB Compounds: (E:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsje1:

Sequence; same for both SEQRES and ATOM records:

>d1xsje1 b.150.1.1 (E:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh

Timeline for d1xsje1:

• d1xsje1 first appeared in SCOP 1.71
  
• d1xsje1 appears in SCOPe 2.01
  
• d1xsje1 appears in SCOPe 2.03
  
• d1xsje1 appears in the current release, SCOPe 2.08