Class b: All beta proteins [48724] (174 folds) |
Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily) sandwich; 10 strands in two sheets |
Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family) |
Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein) |
Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species) |
Species Escherichia coli [TaxId:562] [117128] (5 PDB entries) Uniprot P31434 |
Domain d1xsje1: 1xsj E:666-773 [115967] Other proteins in same PDB: d1xsja2, d1xsja3, d1xsja4, d1xsjb2, d1xsjb3, d1xsjb4, d1xsjc2, d1xsjc3, d1xsjc4, d1xsjd2, d1xsjd3, d1xsjd4, d1xsje2, d1xsje3, d1xsje4, d1xsjf2, d1xsjf3, d1xsjf4 complexed with trs |
PDB Entry: 1xsj (more details), 2.1 Å
SCOPe Domain Sequences for d1xsje1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsje1 b.150.1.1 (E:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]} ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
Timeline for d1xsje1: