Class b: All beta proteins [48724] (178 folds) |
Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily) sandwich; 10 strands in two sheets |
Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) |
Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins) |
Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species) |
Species Escherichia coli [TaxId:562] [117128] (5 PDB entries) Uniprot P31434 |
Domain d1xsid1: 1xsi D:666-772 [115939] Other proteins in same PDB: d1xsia2, d1xsia3, d1xsia4, d1xsia5, d1xsib2, d1xsib3, d1xsib4, d1xsib5, d1xsic2, d1xsic3, d1xsic4, d1xsic5, d1xsid2, d1xsid3, d1xsid4, d1xsid5, d1xsie2, d1xsie3, d1xsie4, d1xsie5, d1xsif2, d1xsif3, d1xsif4, d1xsif5 complexed with acy, mpo, so4 |
PDB Entry: 1xsi (more details), 2.2 Å
SCOPe Domain Sequences for d1xsid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsid1 b.150.1.1 (D:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]} ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
Timeline for d1xsid1:
View in 3D Domains from same chain: (mouse over for more information) d1xsid2, d1xsid3, d1xsid4, d1xsid5 |