Lineage for d1xsib2 (1xsi B:1-247)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391701Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (4 proteins)
    Pfam PF16863
  6. 2391718Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species)
  7. 2391719Species Escherichia coli [TaxId:562] [117141] (5 PDB entries)
    Uniprot P31434
  8. 2391733Domain d1xsib2: 1xsi B:1-247 [115932]
    Other proteins in same PDB: d1xsia1, d1xsia3, d1xsia4, d1xsia5, d1xsib1, d1xsib3, d1xsib4, d1xsib5, d1xsic1, d1xsic3, d1xsic4, d1xsic5, d1xsid1, d1xsid3, d1xsid4, d1xsid5, d1xsie1, d1xsie3, d1xsie4, d1xsie5, d1xsif1, d1xsif3, d1xsif4, d1xsif5
    complexed with acy, mpo, so4

Details for d1xsib2

PDB Entry: 1xsi (more details), 2.2 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (B:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsib2 b.30.5.11 (B:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]}
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptp

SCOPe Domain Coordinates for d1xsib2:

Click to download the PDB-style file with coordinates for d1xsib2.
(The format of our PDB-style files is described here.)

Timeline for d1xsib2: