Lineage for d1xrva2 (1xrv A:240-307)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1022608Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1022830Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1022831Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1022971Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 1022993Species Pig (Sus scrofa) [TaxId:9823] [117869] (4 PDB entries)
    Uniprot Q5UC99
  8. 1022994Domain d1xrva2: 1xrv A:240-307 [115887]
    Other proteins in same PDB: d1xrva1

Details for d1xrva2

PDB Entry: 1xrv (more details), 2.1 Å

PDB Description: crystal structure of the novel secretory signalling protein from porcine (spp-40) at 2.1a resolution.
PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d1xrva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrva2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
fgksftlassktdvgapvsgpgipgqftkekgilayyeicdflqgatthrfrdqqvpyat
kgnqwvay

SCOPe Domain Coordinates for d1xrva2:

Click to download the PDB-style file with coordinates for d1xrva2.
(The format of our PDB-style files is described here.)

Timeline for d1xrva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xrva1