SCOPe 2.05: Domain d1xqub_: 1xqu B:

Lineage for d1xqub_ (1xqu B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein Putative hydrolase [117791] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [117792] (1 PDB entry)
   Uniprot Q4CCR3

8. Domain d1xqub_: 1xqu B: [115856]
   Structural genomics target
   complexed with unx

Details for d1xqub_

PDB Entry: 1xqu, 2.3 Å

PDB Description: hit family hydrolase from clostridium thermocellum cth-393

PDB Compounds: (B:) HIT family hydrolase

SCOPe Domain Sequences for d1xqub_:

Sequence; same for both SEQRES and ATOM records:

>d1xqub_ d.13.1.1 (B:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]}
lencvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqi
lidihkaankvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpkil

Timeline for d1xqub_:

• d1xqub_ first appeared in SCOP 1.71
  
• d1xqub_ appears in SCOPe 2.04
  
• d1xqub_ last appears in SCOPe 2.06