![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) ![]() |
![]() | Family b.34.9.1: Tudor domain [63749] (2 proteins) Pfam 00567 |
![]() | Protein p53-binding protein 1, 53BP1 [110163] (1 species) duplication; contains two Tudor domains in tandem |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110164] (2 PDB entries) |
![]() | Domain d1xnif2: 1xni F:1538-1602 [115593] |
PDB Entry: 1xni (more details), 2.8 Å
SCOP Domain Sequences for d1xnif2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnif2 b.34.9.1 (F:1538-1602) p53-binding protein 1, 53BP1 {Human (Homo sapiens)} ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr eqygl
Timeline for d1xnif2: