SCOP 1.73: Domain d1xnif2: 1xni F:1538-1602

Lineage for d1xnif2 (1xni F:1538-1602)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families)

5. Family b.34.9.1: Tudor domain [63749] (7 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1 [110163] (1 species)
   duplication; contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [110164] (4 PDB entries)

8. Domain d1xnif2: 1xni F:1538-1602 [115593]

Details for d1xnif2

PDB Entry: 1xni, 2.8 Å

PDB Description: Tandem Tudor Domain of 53BP1

PDB Compounds: (F:) tumor suppressor p53-binding protein 1

SCOP Domain Sequences for d1xnif2:

Sequence; same for both SEQRES and ATOM records:

>d1xnif2 b.34.9.1 (F:1538-1602) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqygl

Timeline for d1xnif2:

• d1xnif2 first appeared in SCOP 1.71
  
• d1xnif2 appears in SCOP 1.75
  
• d1xnif2 appears in the current release, SCOPe 2.08