Lineage for d1xnij1 (1xni J:1485-1537)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557875Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 557876Family b.34.9.1: Tudor domain [63749] (2 proteins)
    Pfam 00567
  6. 557877Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 557878Species Human (Homo sapiens) [TaxId:9606] [110164] (2 PDB entries)
  8. 557897Domain d1xnij1: 1xni J:1485-1537 [115600]

Details for d1xnij1

PDB Entry: 1xni (more details), 2.8 Å

PDB Description: Tandem Tudor Domain of 53BP1

SCOP Domain Sequences for d1xnij1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnij1 b.34.9.1 (J:1485-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens)}
sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

SCOP Domain Coordinates for d1xnij1:

Click to download the PDB-style file with coordinates for d1xnij1.
(The format of our PDB-style files is described here.)

Timeline for d1xnij1: