Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein CD3 epsilon chain ectodomain fragment [69162] (3 species) possibly an intermediate structure between the I set and FnIII domains |
Species Mouse (Mus musculus) [TaxId:10090] [69163] (2 PDB entries) Uniprot P22646 22-100 |
Domain d1xmwa1: 1xmw A:1-79 [115566] MQ P22646 P18438 # artificial chimera |
PDB Entry: 1xmw (more details)
SCOPe Domain Sequences for d1xmwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmwa1 b.1.1.4 (A:1-79) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} ddaenieykvsisgtsveltcpldsdenlkwekngqelpqkhdkhlvlqdfsevedsgyy vcytpasnkntylylkarv
Timeline for d1xmwa1: