SCOP 1.71: Domain d1xmwa1: 1xmw A:1-79

Lineage for d1xmwa1 (1xmw A:1-79)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (34 proteins)

6. Protein CD3 epsilon chain ectodomain fragment [69162] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Mouse (Mus musculus) [TaxId:10090] [69163] (2 PDB entries)

8. Domain d1xmwa1: 1xmw A:1-79 [115566]
   MQ P22646 P18438 # artificial chimera

Details for d1xmwa1

PDB Entry: 1xmw

PDB Description: cd3 epsilon and delta ectodomain fragment complex in single-chain construct

SCOP Domain Sequences for d1xmwa1:

Sequence; same for both SEQRES and ATOM records:

>d1xmwa1 b.1.1.4 (A:1-79) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus)}
ddaenieykvsisgtsveltcpldsdenlkwekngqelpqkhdkhlvlqdfsevedsgyy
vcytpasnkntylylkarv

Timeline for d1xmwa1:

• d1xmwa1 is new in SCOP 1.71
  
• d1xmwa1 appears in SCOP 1.73
  
• d1xmwa1 appears in the current release, SCOPe 2.08