Lineage for d1xmop_ (1xmo P:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601312Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 601313Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 601314Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 601315Protein Ribosomal protein S16 [54567] (1 species)
  7. 601316Species Thermus thermophilus [TaxId:274] [54568] (19 PDB entries)
  8. 601328Domain d1xmop_: 1xmo P: [115515]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmok_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
    complexed with mg, mnu, par, t6a, zn

Details for d1xmop_

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

SCOP Domain Sequences for d1xmop_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmop_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1xmop_:

Click to download the PDB-style file with coordinates for d1xmop_.
(The format of our PDB-style files is described here.)

Timeline for d1xmop_: