Lineage for d1xmok_ (1xmo K:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 587067Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 587068Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 587094Protein Ribosomal protein S11 [53141] (1 species)
  7. 587095Species Thermus thermophilus [TaxId:274] [53142] (18 PDB entries)
  8. 587107Domain d1xmok_: 1xmo K: [115510]
    Other proteins in same PDB: d1xmob_, d1xmoc1, d1xmoc2, d1xmod_, d1xmoe1, d1xmoe2, d1xmof_, d1xmog_, d1xmoh_, d1xmoi_, d1xmoj_, d1xmol_, d1xmom_, d1xmon_, d1xmoo_, d1xmop_, d1xmoq_, d1xmor_, d1xmos_, d1xmot_, d1xmov_
    complexed with mg, mnu, par, t6a, zn

Details for d1xmok_

PDB Entry: 1xmo (more details), 3.25 Å

PDB Description: Crystal Structure of mnm5U34t6A37-tRNALysUUU Complexed with AAG-mRNA in the Decoding Center

SCOP Domain Sequences for d1xmok_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmok_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOP Domain Coordinates for d1xmok_:

Click to download the PDB-style file with coordinates for d1xmok_.
(The format of our PDB-style files is described here.)

Timeline for d1xmok_: