Lineage for d1xl4b1 (1xl4 B:139-299)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770929Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)
  6. 1770937Protein Inward rectifier potassium channel kirbac3.1 [117047] (1 species)
  7. 1770938Species Magnetospirillum magnetotacticum [TaxId:188] [117048] (4 PDB entries)
    Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690
  8. 1770940Domain d1xl4b1: 1xl4 B:139-299 [115432]
    Other proteins in same PDB: d1xl4a2, d1xl4b2
    complexed with k, mg

Details for d1xl4b1

PDB Entry: 1xl4 (more details), 2.6 Å

PDB Description: Intermediate gating structure 1 of the inwardly rectifying K+ channel KirBac3.1
PDB Compounds: (B:) Inward rectifier potassium channel

SCOPe Domain Sequences for d1xl4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl4b1 b.1.18.16 (B:139-299) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh

SCOPe Domain Coordinates for d1xl4b1:

Click to download the PDB-style file with coordinates for d1xl4b1.
(The format of our PDB-style files is described here.)

Timeline for d1xl4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xl4b2