SCOPe 2.02: Domain d1xjva2: 1xjv A:149-299

Lineage for d1xjva2 (1xjv A:149-299)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Protection of telomeres protein 1, Pot1 [101761] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117190] (1 PDB entry)
   Uniprot Q9NUX5 6-299

8. Domain d1xjva2: 1xjv A:149-299 [115397]
   protein/DNA complex

Details for d1xjva2

PDB Entry: 1xjv, 1.73 Å

PDB Description: crystal structure of human pot1 bound to telomeric single-stranded dna (ttagggttag)

PDB Compounds: (A:) Protection of telomeres 1

SCOPe Domain Sequences for d1xjva2:

Sequence; same for both SEQRES and ATOM records:

>d1xjva2 b.40.4.3 (A:149-299) Protection of telomeres protein 1, Pot1 {Human (Homo sapiens) [TaxId: 9606]}
tllklcdvqpmqyfdltcqllgkaevdgasfllkvwdgtrtpfpswrvliqdlvlegdls
hihrlqnltidilvydnhvhvarslkvgsflriyslhtklqsmnsenqtmlslefhlhgg
tsygrgirvlpesnsdvdqlkkdlesanlta

Timeline for d1xjva2:

• d1xjva2 first appeared in SCOP 1.71
  
• d1xjva2 appears in SCOPe 2.01
  
• d1xjva2 appears in SCOPe 2.03
  
• d1xjva2 appears in the current release, SCOPe 2.08