SCOP 1.71: Domain d1xjub_: 1xju B:

Lineage for d1xjub_ (1xju B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Endolysin Lyz [117758] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [117759] (2 PDB entries)

8. Domain d1xjub_: 1xju B: [115395]
   structure of secreted inactive form
   complexed with sul

Details for d1xjub_

PDB Entry: 1xju, 1.07 Å

PDB Description: crystal structure of secreted inactive form of p1 phage endolysin lyz

SCOP Domain Sequences for d1xjub_:

Sequence, based on SEQRES records:

>d1xjub_ d.2.1.3 (B:) Endolysin Lyz {Bacteriophage P1}
rtnqaglelignaegcrrdpymcpagvwtdgignthgvtpgvrktdqqiaadweknilia
ercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvn
mcnhlpdfvnsngvplrglkirrekerqlcltglvneh

Sequence, based on observed residues (ATOM records):

>d1xjub_ d.2.1.3 (B:) Endolysin Lyz {Bacteriophage P1}
rtnqaglelignaegcrrdpymcpagvwtdgiggvtpgvrktdqqiaadwekniliaerc
inqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvnmcn
hlpdfvnsngvplrglkirrekerqlcltglvneh

Timeline for d1xjub_:

• d1xjub_ is new in SCOP 1.71
  
• d1xjub_ appears in SCOP 1.73
  
• d1xjub_ appears in the current release, SCOPe 2.08, called d1xjub1