Lineage for d1xjub_ (1xju B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714660Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 714661Protein Endolysin Lyz [117758] (1 species)
  7. 714662Species Bacteriophage P1 [TaxId:10678] [117759] (2 PDB entries)
  8. 714664Domain d1xjub_: 1xju B: [115395]
    structure of secreted inactive form
    complexed with sul

Details for d1xjub_

PDB Entry: 1xju (more details), 1.07 Å

PDB Description: crystal structure of secreted inactive form of p1 phage endolysin lyz
PDB Compounds: (B:) lysozyme

SCOP Domain Sequences for d1xjub_:

Sequence, based on SEQRES records: (download)

>d1xjub_ d.2.1.3 (B:) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]}
rtnqaglelignaegcrrdpymcpagvwtdgignthgvtpgvrktdqqiaadweknilia
ercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvn
mcnhlpdfvnsngvplrglkirrekerqlcltglvneh

Sequence, based on observed residues (ATOM records): (download)

>d1xjub_ d.2.1.3 (B:) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]}
rtnqaglelignaegcrrdpymcpagvwtdgiggvtpgvrktdqqiaadwekniliaerc
inqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvnmcn
hlpdfvnsngvplrglkirrekerqlcltglvneh

SCOP Domain Coordinates for d1xjub_:

Click to download the PDB-style file with coordinates for d1xjub_.
(The format of our PDB-style files is described here.)

Timeline for d1xjub_: