Lineage for d1xjua_ (1xju A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 596519Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 596520Protein Endolysin Lyz [117758] (1 species)
  7. 596521Species Bacteriophage P1 [TaxId:10678] [117759] (2 PDB entries)
  8. 596522Domain d1xjua_: 1xju A: [115394]

Details for d1xjua_

PDB Entry: 1xju (more details), 1.07 Å

PDB Description: crystal structure of secreted inactive form of p1 phage endolysin lyz

SCOP Domain Sequences for d1xjua_:

Sequence, based on SEQRES records: (download)

>d1xjua_ d.2.1.3 (A:) Endolysin Lyz {Bacteriophage P1}
rtnqaglelignaegcrrdpymcpagvwtdgignthgvtpgvrktdqqiaadweknilia
ercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvn
mcnhlpdfvnsngvplrglkirrekerqlcltglvneh

Sequence, based on observed residues (ATOM records): (download)

>d1xjua_ d.2.1.3 (A:) Endolysin Lyz {Bacteriophage P1}
rtnqaglelignaegcrrdpymcpagvwtdgigngvtpgvrktdqqiaadwekniliaer
cinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvnmc
nhlpdfvnsngvplrglkirrekerqlcltglvneh

SCOP Domain Coordinates for d1xjua_:

Click to download the PDB-style file with coordinates for d1xjua_.
(The format of our PDB-style files is described here.)

Timeline for d1xjua_: