Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
Protein NADH oxidase /nitrite reductase [118042] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [118043] (1 PDB entry) Uniprot Q8U1K9 |
Domain d1xhca3: 1xhc A:290-351 [115294] Other proteins in same PDB: d1xhca1, d1xhca2 Structural genomics target complexed with fad |
PDB Entry: 1xhc (more details), 2.35 Å
SCOPe Domain Sequences for d1xhca3:
Sequence, based on SEQRES records: (download)
>d1xhca3 d.87.1.1 (A:290-351) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} prrynfkfrstvfkfgklqiaiigntkgegkwiedntkvfyengkiigavvfndirkatk le
>d1xhca3 d.87.1.1 (A:290-351) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} prrynfkfrstvfkfgklqiaiigntkgegkwiedntkvfyigavvfndirkatkle
Timeline for d1xhca3: