Lineage for d1xg5c_ (1xg5 C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1151047Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1151944Protein Putative dehydrogenase ARPG836 (MGC4172) [117411] (1 species)
  7. 1151945Species Human (Homo sapiens) [TaxId:9606] [117412] (1 PDB entry)
    Uniprot Q6UWP2
  8. 1151948Domain d1xg5c_: 1xg5 C: [115279]
    complexed with acy, nap

Details for d1xg5c_

PDB Entry: 1xg5 (more details), 1.53 Å

PDB Description: Structure of human putative dehydrogenase MGC4172 in complex with NADP
PDB Compounds: (C:) arpg836

SCOPe Domain Sequences for d1xg5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xg5c_ c.2.1.2 (C:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}
arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp
gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn
vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr
qelreaqthiratcispgvvetqfafklhdkdpekaaatyeqmkclkpedvaeaviyvls
tpahiqigdiqmrptgs

SCOPe Domain Coordinates for d1xg5c_:

Click to download the PDB-style file with coordinates for d1xg5c_.
(The format of our PDB-style files is described here.)

Timeline for d1xg5c_: