Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Smc head domain [52693] (3 species) |
Species Pyrococcus furiosus [TaxId:2261] [117545] (2 PDB entries) Uniprot Q877I1 1-167,1012-1173 |
Domain d1xex.1: 1xex A:,B: [115236] complexed with atp, mg |
PDB Entry: 1xex (more details), 2.5 Å
SCOPe Domain Sequences for d1xex.1:
Sequence, based on SEQRES records: (download)
>g1xex.1 c.37.1.12 (A:,B:) Smc head domain {Pyrococcus furiosus [TaxId: 2261]} pyieklelkgfksygnkkvvipfskgftaivgangsgksnigdailfvlgglsakamras risdlifagskneppakyaevaiyfnnedrgfpidedevvirrrvypdgrssywlngrra trseildiltaamispdgynivlqgditkfikmsplerrlliddisXkknvfmrtfeais rnfseifaklspggsarlilenpedpfsggleieakpagkdvkrieamsggekaltalaf vfaiqkfkpapfylfdqidahlddanvkrvadlikesskesqfivitlrdvmmanadkii gvsmrdgvskvvslslekamkileeirkkqg
>g1xex.1 c.37.1.12 (A:,B:) Smc head domain {Pyrococcus furiosus [TaxId: 2261]} pyieklelkgfksygnkkvvipfskgftaivgangsgksnigdailfvlgglsakamras risdlifagskneppakyaevaiyfnnedrgfpidedevvirrrvypdgrssywlngrra trseildiltaamispdgynivlqgditkfikmsplerrlliddisXkknvfmrtfeais rnfseifaklspggsarlilenpfsggleieakpagkdvkrieamsggekaltalafvfa iqkfkpapfylfdqidahlddanvkrvadlikesskesqfivitlrdvmmanadkiigvs mrdgvskvvslslekamkileeirkkqg
Timeline for d1xex.1: