Lineage for d1xbte1 (1xbt E:18-150)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849565Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
    N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)
  6. 1849566Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species)
  7. 1849570Species Human (Homo sapiens) [TaxId:9606] [117560] (2 PDB entries)
    Uniprot P04183 18-191
  8. 1849575Domain d1xbte1: 1xbt E:18-150 [115088]
    Other proteins in same PDB: d1xbta2, d1xbtb2, d1xbtc2, d1xbtd2, d1xbte2, d1xbtf2, d1xbtg2, d1xbth2
    complexed with mg, ttp, zn

Details for d1xbte1

PDB Entry: 1xbt (more details), 2.4 Å

PDB Description: Crystal Structure of Human Thymidine Kinase 1
PDB Compounds: (E:) Thymidine kinase, cytosolic

SCOPe Domain Sequences for d1xbte1:

Sequence, based on SEQRES records: (download)

>d1xbte1 c.37.1.24 (E:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp
acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail
nlvplaesvvklt

Sequence, based on observed residues (ATOM records): (download)

>d1xbte1 c.37.1.24 (E:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt

SCOPe Domain Coordinates for d1xbte1:

Click to download the PDB-style file with coordinates for d1xbte1.
(The format of our PDB-style files is described here.)

Timeline for d1xbte1: