| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.43: EF-Ts domain-like [54712] (2 superfamilies) beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123 |
Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) ![]() comprises two structural repeats of this fold |
| Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein) |
| Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species) |
| Species Cow (Bos taurus), mitochondrial [TaxId:9913] [117891] (1 PDB entry) Uniprot P43896 56-331 |
| Domain d1xb2b3: 1xb2 B:223-331 [115059] Other proteins in same PDB: d1xb2a1, d1xb2a2, d1xb2a3, d1xb2b1 |
PDB Entry: 1xb2 (more details), 2.2 Å
SCOPe Domain Sequences for d1xb2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xb2b3 d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
gfyvgsyvhgamhspslhnlvlgkygalvicetselkanladlgrrlgqhvvgmaplsvg
slddepggeaetkmlsqpylldpsitlgqyvqphgvsvvdfvrfecgeg
Timeline for d1xb2b3: