Lineage for d1xb2b2 (1xb2 B:112-222)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552850Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 2552851Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
    comprises two structural repeats of this fold
  5. 2552852Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 2552853Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)
  7. 2552854Species Cow (Bos taurus), mitochondrial [TaxId:9913] [117891] (1 PDB entry)
    Uniprot P43896 56-331
  8. 2552855Domain d1xb2b2: 1xb2 B:112-222 [115058]
    Other proteins in same PDB: d1xb2a1, d1xb2a2, d1xb2a3, d1xb2b1

Details for d1xb2b2

PDB Entry: 1xb2 (more details), 2.2 Å

PDB Description: Crystal Structure of Bos taurus mitochondrial Elongation Factor Tu/Ts Complex
PDB Compounds: (B:) Elongation factor Ts, mitochondrial

SCOPe Domain Sequences for d1xb2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb2b2 d.43.1.1 (B:112-222) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
grktkegligllqegdttvlvevncetdfvsrnlkfqqlvqqvalgtllhcqnlkdqlst
yskgflnsselselpagperegslkdqlalaigklgenmilkraawvkvpa

SCOPe Domain Coordinates for d1xb2b2:

Click to download the PDB-style file with coordinates for d1xb2b2.
(The format of our PDB-style files is described here.)

Timeline for d1xb2b2: