Lineage for d1x8ha1 (1x8h A:41-307)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) 
Protein Zn metallo-beta-lactamase [56283] (14 species) 
Species Aeromonas hydrophila, CphA [TaxId:644] [118144] (11 PDB entries)
Uniprot P26918 28-252
Domain d1x8ha1: 1x8h A:41-307 [114961]
Other proteins in same PDB: d1x8ha2
complexed with co3, gol, so4, zn; mutant
Details for d1x8ha1
PDB Entry: 1x8h (more details), 1.6 Å
PDB Description: the mono-zinc carbapenemase cpha (n220g mutant) shows a zn(ii)- nh2 arg coordination
PDB Compounds: (A:) Beta-lactamaseSCOPe Domain Sequences for d1x8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x8ha1 d.157.1.1 (A:41-307) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]}
agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqs
SCOPe Domain Coordinates for d1x8ha1:
Click to download the PDB-style file with coordinates for d1x8ha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1x8ha1:
- d1x8ha1 first appeared in SCOP 1.71, called d1x8ha_
- d1x8ha1 appears in SCOPe 2.07
View in 3D
