Lineage for d1x7ua2 (1x7u A:441-748)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005634Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
    duplication: tandem repeat of two CCP-like domains
  6. 2005635Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 2005636Species Burkholderia pseudomallei [TaxId:28450] [89093] (21 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 2005678Domain d1x7ua2: 1x7u A:441-748 [114935]
    complexed with hem, na

Details for d1x7ua2

PDB Entry: 1x7u (more details), 1.9 Å

PDB Description: crystal structure of the s324t of catalase-peroxidase katg
PDB Compounds: (A:) catalase-peroxidase protein KatG

SCOPe Domain Sequences for d1x7ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x7ua2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
nldrfdla

SCOPe Domain Coordinates for d1x7ua2:

Click to download the PDB-style file with coordinates for d1x7ua2.
(The format of our PDB-style files is described here.)

Timeline for d1x7ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x7ua1