Lineage for d1wufa2 (1wuf A:1001-1126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947805Protein N-acylamino acid racemase [110937] (4 species)
  7. 2947847Species Listeria innocua [TaxId:1642] [117926] (1 PDB entry)
    Uniprot Q927X3; Lin2664; protein assignment by sequence similarity
  8. 2947848Domain d1wufa2: 1wuf A:1001-1126 [114897]
    Other proteins in same PDB: d1wufa1, d1wufa3, d1wufb1, d1wufb3
    Structural genomics target
    complexed with mg

Details for d1wufa2

PDB Entry: 1wuf (more details), 2.9 Å

PDB Description: crystal structure of protein gi:16801725, member of enolase superfamily from listeria innocua clip11262
PDB Compounds: (A:) hypothetical protein lin2664

SCOPe Domain Sequences for d1wufa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wufa2 d.54.1.1 (A:1001-1126) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]}
myfqkarlihaelpllapfktsygelkskdfyiielineegihgygeleafplpdyteet
lssailiikeqllpllaqrkirkpeeiqelfswiqgnemakaavelavwdafakmekrsl
akmiga

SCOPe Domain Coordinates for d1wufa2:

Click to download the PDB-style file with coordinates for d1wufa2.
(The format of our PDB-style files is described here.)

Timeline for d1wufa2: