Lineage for d1wq8a_ (1wq8 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260392Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2260404Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 2260405Species Aspic viper (Vipera aspis aspis) [TaxId:8706] [118255] (1 PDB entry)
    Uniprot P67863 1-100 # svVEGF (toxin); vammin
  8. 2260406Domain d1wq8a_: 1wq8 A: [114832]
    complexed with trs

Details for d1wq8a_

PDB Entry: 1wq8 (more details), 1.9 Å

PDB Description: crystal structure of vammin, a vegf-f from a snake venom
PDB Compounds: (A:) Vascular endothelial growth factor toxin

SCOPe Domain Sequences for d1wq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wq8a_ g.17.1.1 (A:) Vascular endothelial growth factor, VEGF {Aspic viper (Vipera aspis aspis) [TaxId: 8706]}
evrpflevhersacqaretlvpilqeypdeisdifrpscvavlrcsgcctdeslkctpvg
khtvdiqimrvnprtqsskmevmkftehtacecrprrkqg

SCOPe Domain Coordinates for d1wq8a_:

Click to download the PDB-style file with coordinates for d1wq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1wq8a_: