SCOPe 2.03: Domain d1wpca1: 1wpc A:399-485

Lineage for d1wpca1 (1wpc A:399-485)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Bacillus sp. 707 [TaxId:1416] [117297] (4 PDB entries)
   Uniprot P19571 38-518

8. Domain d1wpca1: 1wpc A:399-485 [114799]
   Other proteins in same PDB: d1wpca2
   complexed with ca, na

Details for d1wpca1

PDB Entry: 1wpc, 1.9 Å

PDB Description: crystal structure of maltohexaose-producing amylase complexed with pseudo-maltononaose

PDB Compounds: (A:) Glucan 1,4-alpha-maltohexaosidase

SCOPe Domain Sequences for d1wpca1:

Sequence; same for both SEQRES and ATOM records:

>d1wpca1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. 707 [TaxId: 1416]}
gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr
tgtvtinadgwgnfsvnggsvsiwvnk

Timeline for d1wpca1:

• d1wpca1 first appeared in SCOP 1.71
  
• d1wpca1 appears in SCOPe 2.02
  
• d1wpca1 appears in SCOPe 2.04
  
• d1wpca1 appears in the current release, SCOPe 2.08