Lineage for d1woab_ (1woa B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826027Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2826028Protein Triosephosphate isomerase [51353] (21 species)
  7. 2826142Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (31 PDB entries)
    Uniprot Q07412
  8. 2826203Domain d1woab_: 1woa B: [114771]
    complexed with g2h; mutant

Details for d1woab_

PDB Entry: 1woa (more details), 2.8 Å

PDB Description: structure of the loop6 hinge mutant of plasmodium falciparum triosephosphate isomerase, w168f, complexed with glycerol-2-phosphate
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1woab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woab_ c.1.1.1 (B:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplfaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

SCOPe Domain Coordinates for d1woab_:

Click to download the PDB-style file with coordinates for d1woab_.
(The format of our PDB-style files is described here.)

Timeline for d1woab_: