Lineage for d1wnrc_ (1wnr C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122089Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1122090Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1122091Family b.35.1.1: GroES [50130] (2 proteins)
  6. 1122092Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 1122173Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
    Uniprot P61493 ! Uniprot P61492
  8. 1122190Domain d1wnrc_: 1wnr C: [114757]

Details for d1wnrc_

PDB Entry: 1wnr (more details), 2.9 Å

PDB Description: Crystal structure of the Cpn10 from Thermus thermophilus HB8
PDB Compounds: (C:) 10 kda chaperonin

SCOPe Domain Sequences for d1wnrc_:

Sequence, based on SEQRES records: (download)

>d1wnrc_ b.35.1.1 (C:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
gdivvfakyggteieidgeeyvilserdllavlq

Sequence, based on observed residues (ATOM records): (download)

>d1wnrc_ b.35.1.1 (C:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
mikplgdrvvvkrivlpdtakekpqkgkviavgtgrvlengqrvplevkegdivvfakyg
gteieidgeeyvilserdllavlq

SCOPe Domain Coordinates for d1wnrc_:

Click to download the PDB-style file with coordinates for d1wnrc_.
(The format of our PDB-style files is described here.)

Timeline for d1wnrc_: