Lineage for d1wi3a1 (1wi3 A:8-65)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981565Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1981574Protein DNA-binding protein SATB2 [116776] (1 species)
  7. 1981575Species Human (Homo sapiens) [TaxId:9606] [116777] (1 PDB entry)
    Uniprot Q9UPW6 615-672 # the structure of the 1st CUT domain (350-437) is also known: 1WIZ
  8. 1981576Domain d1wi3a1: 1wi3 A:8-65 [114660]
    Other proteins in same PDB: d1wi3a2, d1wi3a3
    Structural genomics target

Details for d1wi3a1

PDB Entry: 1wi3 (more details)

PDB Description: solution structure of the homeodomain of kiaa1034 protein
PDB Compounds: (A:) DNA-binding protein SATB2

SCOPe Domain Sequences for d1wi3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi3a1 a.4.1.1 (A:8-65) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]}
prsrtkislealgilqsfihdvglypdqeaihtlsaqldlpkhtiikffqnqryhvkh

SCOPe Domain Coordinates for d1wi3a1:

Click to download the PDB-style file with coordinates for d1wi3a1.
(The format of our PDB-style files is described here.)

Timeline for d1wi3a1: