Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein DNA-binding protein SATB2 [116776] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [116777] (1 PDB entry) Uniprot Q9UPW6 615-672 # the structure of the 1st CUT domain (350-437) is also known: 1WIZ |
Domain d1wi3a1: 1wi3 A:8-65 [114660] Other proteins in same PDB: d1wi3a2, d1wi3a3 Structural genomics target |
PDB Entry: 1wi3 (more details)
SCOPe Domain Sequences for d1wi3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wi3a1 a.4.1.1 (A:8-65) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} prsrtkislealgilqsfihdvglypdqeaihtlsaqldlpkhtiikffqnqryhvkh
Timeline for d1wi3a1: