Lineage for d1wd7a1 (1wd7 A:10-261)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528371Fold c.113: HemD-like [69617] (1 superfamily)
    duplication: consists of two similar 'swapped' domain with 3 layers (a/b/a) each; parallel beta-sheet of 5 strands, order 21345
  4. 2528372Superfamily c.113.1: HemD-like [69618] (1 family) (S)
    automatically mapped to Pfam PF02602
  5. 2528373Family c.113.1.1: HemD-like [69619] (3 proteins)
    Pfam PF02602
  6. 2528374Protein Probable uroporphyrinogen-III synthase [117738] (1 species)
  7. 2528375Species Thermus thermophilus [TaxId:274] [117739] (1 PDB entry)
    Uniprot Q5SKH2; TTHA0671
  8. 2528376Domain d1wd7a1: 1wd7 A:10-261 [114526]
    Other proteins in same PDB: d1wd7a2, d1wd7b2
    Structural genomics target

Details for d1wd7a1

PDB Entry: 1wd7 (more details), 1.6 Å

PDB Description: Crystal Structure of Uroporphyrinogen III Synthase from an Extremely Thermophilic Bacterium Thermus thermophilus HB8 (Wild type, Native, Form-2 crystal)
PDB Compounds: (A:) Uroporphyrinogen III Synthase

SCOPe Domain Sequences for d1wd7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd7a1 c.113.1.1 (A:10-261) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]}
rvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflattgv
gvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpllpq
grgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdalaf
vaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgsll
qgfkralqkeva

SCOPe Domain Coordinates for d1wd7a1:

Click to download the PDB-style file with coordinates for d1wd7a1.
(The format of our PDB-style files is described here.)

Timeline for d1wd7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wd7a2