Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
Species Sulfolobus solfataricus [TaxId:2287] [54730] (2 PDB entries) Uniprot P80857 |
Domain d1wb8b2: 1wb8 B:93-208 [114485] Other proteins in same PDB: d1wb8a1, d1wb8b1 complexed with fe, pms |
PDB Entry: 1wb8 (more details), 2.3 Å
SCOPe Domain Sequences for d1wb8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb8b2 d.44.1.1 (B:93-208) Fe superoxide dismutase (FeSOD) {Sulfolobus solfataricus [TaxId: 2287]} psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl
Timeline for d1wb8b2: