Lineage for d1wb8a1 (1wb8 A:4-92)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303512Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2303540Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 2303630Species Sulfolobus solfataricus [TaxId:2287] [46616] (2 PDB entries)
    Uniprot P80857
  8. 2303631Domain d1wb8a1: 1wb8 A:4-92 [114482]
    Other proteins in same PDB: d1wb8a2, d1wb8b2
    complexed with fe, pms

Details for d1wb8a1

PDB Entry: 1wb8 (more details), 2.3 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosine in the active site.
PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d1wb8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Sulfolobus solfataricus [TaxId: 2287]}
iqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdlqtg
qydiqgiirgltfninghklhalywenma

SCOPe Domain Coordinates for d1wb8a1:

Click to download the PDB-style file with coordinates for d1wb8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wb8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wb8a2